Edit |   |
---|---|
Antigenic Specificity | TAF9B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 4.59 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene enco |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF9B (NP 057059.2). Immunogen Sequence: ILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGA |
Other Names | [TAF9B; DN-7; DN7; TAF9L; TAFII31L; TFIID-31; TATA-box binding protein associated factor 9b] |
Gene, Accession # | [TAF9B], Gene ID: 51616, UniProt: Q9HBM6 |
Catalog # | MBS9140553 |
Price | $260 |
Order / More Info | TAF9B Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |