Ogg1 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Ogg1 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Ogg1 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: 8-Oxoguanine glycosylase also known as OGG1 is a DNA glycosylase enzyme that, in humans, is encoded by theOGG1 gene. This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial loca |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human Ogg1 (KYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQD). Subcellular Localization: Nucleus, nucleoplasm. Tissue Specificity: Ubiquitous. |
| Other Names | [N-glycosylase/DNA lyase; 8-oxoguanine DNA glycosylase; DNA-(apurinic or apyrimidinic site) lyase; AP lyase; OGG1; MMH; MUTM; OGH1] |
| Gene, Accession # | [Ogg1], Gene ID: 4968, NCBI: NP_002533.1, UniProt: O15527 |
| Catalog # | MBS1750482 |
| Price | $280 |
| Order / More Info | Ogg1 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies