IFNGR1/Cd119 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-IFNGR1/Cd119 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | IFNGR1/Cd119 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.Protein Function: Associates with IFNGR2 to form a receptor for the cytokine interferon gamma (IFNG) (PubMed: 7615558, PubMed: 2971451, PubMed: 7617032, |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108-147aa QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH), different from the related mouse sequence by eighteen amino acids. Subcellular Localization: Cell membrane; Single-pass type I membrane protein. |
| Other Names | [Interferon gamma receptor 1; IFN-gamma receptor 1; IFN-gamma-R1; CDw119; CD119; IFNGR1] |
| Gene, Accession # | [IFNGR1], Gene ID: 3459, NCBI: NP_000407.1, UniProt: P15260 |
| Catalog # | MBS1750702 |
| Price | $280 |
| Order / More Info | IFNGR1/Cd119 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies