MCUR1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-MCUR1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | MCUR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for MCUR1 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: MCUR1 is an inner mitochondrial membrane protein that has been shown to function as a component of the mitochondrial Ca (2+) uniporter, in the assembly of mitochondrial respiratory complex IV, and in mitochondrial permeability transition (MPT). The MCUR1 gene is mapped to chromosome 6p23 based on an alignment of the MCUR1 sequence with the genomic sequence. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human MCUR1 (ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE). |
| Other Names | [Mitochondrial calcium uniporter regulator 1; MCU regulator 1; Coiled-coil domain-containing protein 90A, mitochondrial; MCUR1; C6orf79; CCDC90A] |
| Gene, Accession # | [MCUR1], Gene ID: 63933, NCBI: NP_001026883.1, UniProt: Q96AQ8 |
| Catalog # | MBS1751512 |
| Price | $315 |
| Order / More Info | MCUR1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Chaudhuri, D., Artiga, D. J., Abiria, S. A., Clapham, D. E. Mitochondrial calcium uniporter regulator 1 (MCUR1) regulates the calcium threshold for the mitochondrial permeability transition. Proc. Nat. Acad. Sci. 113: E1872-E1880, 2016. 2. Hartz, P. A. Personal Communication. Baltimore, Md. 5/23/2016. 3. Mallilankaraman, K., Cardenas, C., Doonan, P. J., Chandramoorthy, H. C., Irrinki, K. M., Golenar, T., Csordas, G., Madireddi, P., Yang, J., Muller, M., Miller, R., Kolesar, J. E., Molgo, J., Kaufman, B., Hajnoczky, G., Foskett, J. K., Madesh, M. MCUR1 is an essential component of mitochondrial Ca (2 ) uptake that regulates cellular metabolism. Nature Cell Biol. 14: 1336-1343, 2012. Note: Erratum: Nature Cell Biol. 15: 123 only, 2013. Erratum: Nature Cell Biol. 17: 953 only, 2015. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies