Edit |   |
---|---|
Antigenic Specificity | MXD4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 1.79 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene is a member of the MAD gene family. The MAD genes encode basic helix-loop-helix-leucine zipper proteins that heterodimerize with MAX protein, forming a transcriptional repression complex. The MAD proteins compete for MAX binding with MYC, which heterodimerizes with MAX forming a transcriptional activation complex. Studies in rodents suggest that the MAD genes are tumor suppressors and contribute to the regulation of cell growth in differentiating tissues. |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-209 of human MXD4 (NP 006445.1). Immunogen Sequence: RRALSIKEQLQQEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDADDHYSLQSGTGGDSGFGPHCRRLGRPALS |
Other Names | [MXD4; MAD4; MST149; MSTP149; bHLHc12; max dimerization protein 4] |
Gene, Accession # | [MXD4], Gene ID: 10608, NCBI: NP_006445.1, UniProt: Q14582 |
Catalog # | MBS9140875 |
Price | $260 |
Order / More Info | MXD4 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |