SFTPB/Surfactant Protein B Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SFTPB/Surfactant Protein B Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SFTPB/Surfactant Protein B Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Pulmonary surfactant-associated protein B is a protein that in humans is encoded by the SFTPB gene. This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this g |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human SFTPB (QCLAERYSVILLDTLLGRMLPQLVCRLVLR). Subcellular Localization: Secreted, extracellular space, surface film. |
| Other Names | [Pulmonary surfactant-associated protein B; SP-B; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe); SFTPB; SFTP3] |
| Gene, Accession # | [SFTPB], Gene ID: 6439, NCBI: NP_000533.3, UniProt: P07988 |
| Catalog # | MBS1750834 |
| Price | $280 |
| Order / More Info | SFTPB/Surfactant Protein B Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies