Rab18 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Rab18 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Rab18 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Ras-related protein Rab-18(RAB18) detection. Tested with WB in Human;Rat. Background: Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab18 (156-192aa DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. Ig Type: Rabbit IgG |
| Other Names | [Ras-related protein Rab-18; AA959686; RAB18; RAB18 small GTPase; RAB18, member RAS oncogene family; RAB18_HUMAN; RAB18LI1; Ras related protein Rab 18; Ras-asssociated protein RAB18; Ras-related protein Rab-18; RP11-148B2.1; WARBM3; RAB18, member RAS oncogene family], [RAB18; RAB18; WARBM3; RAB18LI1] |
| Gene, Accession # | [RAB18], Gene ID: 22931, NCBI: NP_001243339.1, UniProt: Q9NP72 |
| Catalog # | MBS177784 |
| Price | $280 |
| Order / More Info | Rab18 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: RAB18 RAB18, member RAS oncogene family. 2. Lutcke A, Parton RG, Murphy C, Olkkonen VM, Dupree P, Valencia A, Simons K, Zerial M (December 1994). Cloning and subcellular localization of novel rab proteins reveals polarized and cell type-specific expression. J. Cell. Sci. 107 (12): 3437-48. 3. Schafer U, Seibold S, Schneider A, Neugebauer E (Feb 2000). Isolation and characterisation of the human rab18 gene after stimulation of endothelial cells with histamine. FEBS Lett 466 (1): 148-54. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies