ErbB 4 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ErbB 4 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ErbB 4 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: ERBB4(V-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4) also known as ONCOGENE ERBB4 or HER4, is an enzyme that in humans is encoded by the ERBB4 gene. The HER4/ERBB4 gene is a member of the type I receptor tyrosine kinase subfamily that includes EGFR, ERBB2 and ERBB3. This gene is mapped on 2q34. ERBB4 is a single-pass type I transmembrane protein with multiple furin-like cysteine rich domains, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domainbinding motif. Furthermore, ERBB4 is a transmembrane receptor tyrosine kinase that regulates cell proliferation and differentiation. After binding its ligand, heregulin, or activation of protein kinase C by TPA, the ERBB4 ectodomain is |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human ErbB 4 (SLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLR). Subcellular Localization: Cell membrane. Tissue Specificity: Expressed at highest levels in brain, heart, kidney, in addition to skeletal muscle, parathyroid, cerebellum, pituitary, spleen, testis and breast. Lower levels in thymus, lung, salivary gland, and pancreas. Isoform JM-A CYT-1 and isoform JM-B CYT-1 are expressed in cerebellum, but only the isoform JM-B is expressed i |
| Other Names | [Receptor tyrosine-protein kinase erbB-4; Proto-oncogene-like protein c-ErbB-4; Tyrosine kinase-type cell surface receptor HER4; p180erbB4; ERBB4 intracellular domain; 4ICD; E4ICD; s80HER4; ERBB4; HER4] |
| Gene, Accession # | [ERBB4], Gene ID: 2066, NCBI: NP_001036064.1, UniProt: Q15303 |
| Catalog # | MBS1750368 |
| Price | $315 |
| Order / More Info | ErbB 4 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies