Edit |   |
Antigenic Specificity | PGP9.5 |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for Ubiquitin carboxyl-terminal hydrolase isozyme L1(UCHL1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase ac |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids. Ig Type: Rabbit IgG |
Other Names | [Ubiquitin carboxyl-terminal hydrolase isozyme L1; Neuron cytoplasmic protein 9.5; OTTHUMP00000218137; OTTHUMP00000218139; OTTHUMP00000218140; OTTHUMP00000218141; Park 5; PARK5; PGP 9.5; PGP9.5; PGP95; Protein gene product 9.5; Ubiquitin C terminal esterase L1; Ubiquitin C terminal hydrolase; Ubiquitin carboxyl terminal esterase L1; Ubiquitin carboxyl terminal hydrolase isozyme L1; Ubiquitin carboxyl-terminal hydrolase isozyme L1; Ubiquitin thioesterase L1; Ubiquitin thiolesterase; Ubiquitin thiolesterase L1; UCH-L1; UCHL1; UCHL1_HUMAN; ubiquitin C-terminal hydrolase L1], [UCHL1; UCHL1; NDGOA; PARK5; PGP95; PGP9.5; Uch-L1; HEL-117; PGP 9.5; HEL-S-53; UCH-L1; PGP9.5] |
Gene, Accession # | [PGP9.5], Gene ID: 7345, NCBI: NP_004172.2, UniProt: P09936 |
Catalog # | MBS178319 |
Price | $315 |
Order / More Info | PGP9.5 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Entrez Gene: UCHL1 ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase). 2. Das C, Hoang QQ, Kreinbring CA, Luchansky SJ, Meray RK, Ray SS, Lansbury PT, Ringe D, Petsko GA (Mar 2006). Structural basis for conformational plasticity of the Parkinson's disease-associated ubiquitin hydrolase UCH-L1. Proceedings of the National Academy of Sciences of the United States of America 103 (12): 4675-80. 3. Doran JF, Jackson P, Kynoch PA, Thompson RJ (Jun 1983). Isolation of PGP 9.5, a new human neurone-specific protein detected by high-resolution two-dimensional electrophoresis. Journal of Neurochemistry 40 (6): 1542-7. |