Edit |   |
---|---|
Antigenic Specificity | Claudin 18 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: Claudin 18 antibody was raised against the middle region of CLDN18. Rabbit polyclonal Claudin 18 antibody raised against the middle region of CLDN18 |
Immunogen | Immunogen: Claudin 18 antibody was raised using the middle region of CLDN18 corresponding to a region with amino acids YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY |
Other Names | [Claudin 18; Claudin 18; CLDN18; Claudin 18; Claudin -18], [CLDN18; CLDN18; SFTA5; SFTPJ] |
Gene, Accession # | Gene ID: 51208, NCBI: NP_001002026.1 |
Catalog # | MBS839700 |
Price | $430 |
Order / More Info | Claudin 18 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |