Edit |   |
---|---|
Antigenic Specificity | MAS1L |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.27 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | n/a |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MAS1L (NP 443199.1). Immunogen Sequence: MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQ |
Other Names | [MAS1L; MAS-L; MRG; dJ994E9.2; mas-related G-protein coupled receptor MRG] |
Gene, Accession # | [MAS1L], Gene ID: 116511, NCBI: NP_443199.1, UniProt: P35410 |
Catalog # | MBS9140757 |
Price | $260 |
Order / More Info | MAS1L Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |