Aquaporin 1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Aquaporin 1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Aquaporin 1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Aquaporin-1(AQP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid. Ig Type: Rabbit IgG |
| Other Names | [Aquaporin-1; AQP 1; AQP CHIP; AQP-1; AQP1; AQP1_HUMAN; Aquaporin CHIP; Aquaporin-1; Aquaporin-CHIP; Aquaporin1; Channel forming integral protein 28kDa; Channel like integral membrane protein 28 kDa; CHIP 28; CHIP28; CO; Colton blood group; Growth factor induced delayed early response protein; MGC26324; Urine water channel; Water channel protein CHIP 29; Water channel protein CHIP29; Water channel protein for red blood cells and kidney proximal tubule; aquaporin 1], [AQP1; AQP1; CO; CHIP28; AQP-CHIP; CHIP28; AQP-1] |
| Gene, Accession # | Gene ID: 358, NCBI: NP_001171989.1, UniProt: P29972 |
| Catalog # | MBS177933 |
| Price | $315 |
| Order / More Info | Aquaporin 1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Denker, B. M.; Smith, B. L.; Kuhajda, F. P.; Agre, P. : Identification, purification, and partial characterization of a novel M(r) 28,000 integral membrane protein from erythrocytes and renal tubules. J. Biol. Chem. 263: 15634-15642, 1988. 2. Thiagarajah, J. R.; Verkman, A. S. : Aquaporin deletion in mice reduces corneal water permeability and delays restoration of transparency after swelling. J. Biol. Chem. 277: 19139-19144, 2002. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies