FPRL1 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-FPRL1 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | FPRL1 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: N-formyl peptide receptor 2 (FPR2) is a G-protein coupled receptor (GPCR) located on the surface of many cell types of various animal species. The human receptor protein is encoded by the FPR2 gene and is activated to regulate cell function by binding any one of a wide variety of ligands including not only certain N-Formylmethionine-containing oligopeptides such as N-Formylmethionine-leucyl-phenylalanine (FMLP) but also the polyunsaturated fatty acid metabolite of arachidonic acid, lipoxin A4 (LXA4). Moreover, FPR2 mediates responses to a wide range of polypeptides and proteins which may serve to promote inflammation or regulate activities not directly involving inflammation.Protein Function: Low affinity receptor for N-for |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human FPRL1 (TIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR). Subcellular Localization: Cell membrane; Multi-pass membrane protein. Tissue Specificity: Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis. |
| Other Names | [N-formyl peptide receptor 2; FMLP-related receptor I; FMLP-R-I; Formyl peptide receptor-like 1; HM63; Lipoxin A4 receptor; LXA4 receptor; RFP; FPR2; FPRH1; FPRL1; LXA4R] |
| Gene, Accession # | [FPRL1], Gene ID: 2358, NCBI: NP_001005738.1, UniProt: P25090 |
| Catalog # | MBS1750734 |
| Price | $315 |
| Order / More Info | FPRL1 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies