Edit |   |
---|---|
Antigenic Specificity | HEY1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 0.91 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HEY1 (NP 001269780.1). Immunogen Sequence: IIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV |
Other Names | [HEY1; BHLHb31; CHF2; HERP2; HESR1; HRT-1; OAF1; hHRT1; hairy/enhancer-of-split related with YRPW motif protein 1] |
Gene, Accession # | [HEY1], Gene ID: 23462, NCBI: NP_001035798.1, UniProt: Q9Y5J3 |
Catalog # | MBS9140721 |
Price | $260 |
Order / More Info | HEY1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |