Peptide tyrosine tyrosine Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Peptide tyrosine tyrosine antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Peptide tyrosine tyrosine |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | n/a |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mL |
| Concentration | n/a |
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Recognizes PYY in a wide range of species. Peptide tyrosine tyrosine (PYY) is a 36 amino acid peptide, originally isolated from porcine gut, which exhibits striking sequence homology with members of the pancreatic polypeptide family, including neuropeptide tyrosine (NPY). The peptide is localised to enteroglucagon-containing (L/EG) and pancreatic (A) cells in many mammalian and nonmammalian species. PYY gene expression is upregulated by various growth factors, including growth hormone and insulin-like growth factor-1 and the physiological effects of PYY are mediated by G-protein (Galphai2) coupled Y-type receptors (‘Y2 receptors of a PYY-preferring subtype’). Various actions have been reported for PYY, including the inhibition o |
| Immunogen | Immunogen: Natural pig PYY (peptide with tyrosine; HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.). |
| Other Names | [Peptide YY; PYY; Peptide tyrosine tyrosine, pAb], [PYY; PYY; PYY] |
| Gene, Accession # | Gene ID: 100512433, NCBI: P68005.1, UniProt: P68005 |
| Catalog # | MBS565786 |
| Price | $460 |
| Order / More Info | Peptide tyrosine tyrosine Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies