Keratocan Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Keratocan antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Keratocan |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Keratocan(KERA) detection. Tested with WB in Human;Mouse. Background: Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Keratocan (77-109aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN), different from the related mouse sequence by two amino acids. Ig Type: Rabbit IgG |
| Other Names | [Keratocan; CNA2; KERA; KERA_HUMAN; Keratan sulfate proteoglycan keratocan; Keratocan; KTN; SLRR2B; keratocan], [KERA; KERA; KTN; CNA2; SLRR2B; SLRR2B; KTN] |
| Gene, Accession # | Gene ID: 11081, NCBI: NP_008966.1, UniProt: O60938 |
| Catalog # | MBS177729 |
| Price | $280 |
| Order / More Info | Keratocan Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: KERA keratocan. 2. Pellegata NS, Dieguez-Lucena JL, Joensuu T, Lau S, Montgomery KT, Krahe R, Kivela T, Kucherlapati R, Forsius H, de la Chapelle A (Jun 2000). Mutations in KERA, encoding keratocan, cause cornea plana. Nat Genet 25(1): 91-5. 3. Tasheva ES, Funderburgh JL, Funderburgh ML, Corpuz LM, Conrad GW (Jan 2000). Structure and sequence of the gene encoding human keratocan. DNA Seq 10 (1): 67-74. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies