VASP Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-VASP antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | VASP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Vasodilator-stimulated phosphoprotein(VASP) detection. Background: Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that r |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human VASP (78-114aa NFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALE), different from the related mouse sequence by four amino acids. |
| Other Names | [VASP; P50552; Vasodilator-stimulated phosphoprotein], [VASP; VASP; VASP] |
| Gene, Accession # | [VASP], Gene ID: 7408, NCBI: NP_003361.1, UniProt: P50552 |
| Catalog # | MBS178599 |
| Price | $315 |
| Order / More Info | VASP Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Zimmer M, Fink T, Fischer L, Hauser W, Scherer K, Lichter P, Walter U (January 1997). Cloning of the VASP (vasodilator-stimulated phosphoprotein) genes in human and mouse: structure, sequence, and chromosomal localization. Genomics. 36 (2): 227-33.2. Harbeck, B; Huttelmaier S; Schluter K; Jockusch B M; Illenberger S (October 2000). Phosphorylation of the vasodilator-stimulated phosphoprotein regulates its interaction with actin. J. Biol. Chem. UNITED STATES.275 (40): 30817-25.3. Reinhard, M; Giehl K; Abel K; Haffner C; Jarchau T; Hoppe V; Jockusch B M; Walter U (April 1995). The proline-rich focal adhesion and microfilament protein VASP is a ligand for profilins. EMBO J. ENGLAND.14 (8): 1583-9. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies