NM23A Antibody from MYBIOSOURCE INC.

Search, find, compare suppliers for anti-NM23A antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityNM23A
Clonepolyclonal
Host Speciesn/a
Reactive Specieshuman, mouse, rat
Isotypen/a
Formatimmunogen affinity purified
Size0.1 mg
Concentrationn/a
ApplicationsWestern Blot (WB)
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionDescription: Rabbit IgG polyclonal antibody for Nucleoside diphosphate kinase A(NME1) detection. Tested with WB in Human;Mouse;Rat. Background: NME1(NME/NM23 nucleoside diphosphate kinase 1), also called non-metastatic cells 1, protein (NM23A) expressed in, NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration
ImmunogenImmunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids. Ig Type: Rabbit IgG
Other Names[Nucleoside diphosphate kinase A; AWD; AWD, drosophila, homolog of; GAAD; Granzyme A activated DNase; Granzyme A-activated DNase; GZMA activated DNase; Metastasis inhibition factor NM23; NB; NBS; NDK A; NDKA; NDKA_HUMAN; NDP kinase A; NDPK-A; NDPKA; NM23; NM23 long variant, included; nm23-H1; NM23-M1; NM23H1B, included; NME/NM23 nucleoside diphosphate kinase 1; Nme1; NME1-NME2 spliced read-through transcript, included; Non-metastatic cells 1, protein (NM23A) expressed in; Nonmetastatic cells 1, protein expressed in; Nonmetastatic protein 23; Nonmetastatic protein 23, homolog 1; Nucleoside diphosphate kinase A; Tumor metastatic process-associated protein; NME/NM23 nucleoside diphosphate kinase 1], [NME1; NME1; NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1; NDPKA; NM23; NDK A; NDP kinase A; GAAD]
Gene, Accession #[NM23A], Gene ID: 4830, NCBI: NP_000260.1, UniProt: P15531
Catalog #MBS178357
Price$315
Order / More InfoNM23A Antibody from MYBIOSOURCE INC.
Product Specific References1. Chang, C. L., Zhu, X., Thoraval, D. H., Ungar, D., Rawwas, J., Hora, N., Strahler, J. R., Hanash, S. M., Radany, E. nm23-H1 mutation in neuroblastoma. (Letter) Nature 370: 335-336, 1994. 2. Dammai, V., Adryan, B., Lavenburg, K. R., Hsu, T. Drosophila awd, the homolog of human nm23, regulates FGF receptor levels and functions synergistically with shi/dynamin during tracheal development. Genes Dev. 17: 2812-2824, 2003. 3. Dooley, S., Seib, T., Engel, M., Theisinger, B., Janz, H., Piontek, K., Zang, K.-D., Welter, C. Isolation and characterization of the human genomic locus coding for the putative metastasis control gene nm23-H1. Hum. Genet. 93: 63-66, 1994.
MYBIOSOURCE INC.
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166

sales@mybiosource.com

http://www.MyBioSource.com

Profile of MYBIOSOURCE INC.
Return to Antibodies

© 1980 - 2024 Linscott's Directory, Linscott's USA. All rights reserved.