Edit |   |
---|---|
Antigenic Specificity | STK26 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.23 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 297-416 of human STK26 (NP 057626.2). Immunogen Sequence: EGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP |
Other Names | [STK26; MASK; MST4; serine/threonine kinase 26] |
Gene, Accession # | [STK26], Gene ID: 51765, NCBI: NP_001035917.1, UniProt: Q9P289 |
Catalog # | MBS9140901 |
Price | $260 |
Order / More Info | STK26 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |