Edit |   |
---|---|
Antigenic Specificity | Renin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | Protein A purified |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: Renin antibody was raised against the C terminal of REN. Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia. |
Immunogen | Immunogen: Renin antibody was raised using the C terminal of REN corresponding to a region with amino acids YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA |
Other Names | [Rabbit Renin raised against the C terminal of REN; Renin; Renin; REN; FLJ10761] |
Gene, Accession # | [REN], Gene ID: 5972, UniProt: P00797 |
Catalog # | MBS5313165 |
Price | $400 |
Order / More Info | Renin Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |