RBM39 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-RBM39 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | RBM39 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.1 mL |
| Concentration | 1.33 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene encodes a member of the U2AF65 family of proteins. The encoded protein is found in the nucleus, where it co-localizes with core spliceosomal proteins. It has been shown to play a role in both steroid hormone receptor-mediated transcription and alternative splicing, and it is also a transcriptional coregulator of the viral oncoprotein v-Rel. Multiple transcript variants have been observed for this gene. A related pseudogene has been identified on chromosome X. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human RBM39 (NP 001229528.1). Immunogen Sequence: ATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR |
| Other Names | [RBM39; CAPER; CAPERalpha; FSAP59; HCC1; RNPC2; RNA-binding protein 39] |
| Gene, Accession # | [RBM39], Gene ID: 9584, NCBI: NP_001229528.1, UniProt: Q14498 |
| Catalog # | MBS9140483 |
| Price | $260 |
| Order / More Info | RBM39 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies