TSLP Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TSLP Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TSLP Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Thymic stromal lymphopoietin, also called TSLP is a protein belonging to the cytokine family. This gene is mapped to 5q22.1. It encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2(TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target fo |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of mouse TSLP (QEMAQEVQNICLNQTSQILRLWYSFMQSPE). |
| Other Names | [Thymic stromal lymphopoietin; Thymic stroma-derived lymphopoietin; Tslp] |
| Gene, Accession # | [TSLP], Gene ID: 53603, NCBI: NP_067342.1, UniProt: Q9JIE6 |
| Catalog # | MBS1750567 |
| Price | $280 |
| Order / More Info | TSLP Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies