STAT1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-STAT1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | STAT1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 1-alpha/beta (STAT1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: The crystal structure of the DNA complex of a 67-kD core fragment of the STAT1 homodimer was determined, lacking only the N-domain and the C-terminal transcriptional activation domain, at 2.9-angstrom resolution. Phosphorylation of Signal Transducer and Activator of transcription 1(STAT 1) was also decreased in rheumatoid arthritis lymphocytes. The transcription factor signal transducer and activator of transcription-1 (STAT1) plays a key role in immunity against mycobacterial and viral infections. Activation of the signal transducers and activators of transcri |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human STAT1 (114-143aa KILENAQRFNQAQSGNIQSTVMLDKQKELD), different from the related mouse sequence by two amino acids. Ig Type: Rabbit IgG |
| Other Names | [Signal transducer and activator of transcription 1-alpha/beta; Signal transducer and activator of transcription 1 91kD; DKFZp686B04100; ISGF 3; ISGF-3; OTTHUMP00000163552; OTTHUMP00000165046; OTTHUMP00000165047; OTTHUMP00000205845; Signal transducer and activator of transcription 1 91kDa; Signal transducer and activator of transcription 1 alpha/ beta; Signal transducer and activator of transcription 1; Signal transducer and activator of transcription 1, 91kD; Signal transducer and activator of transcription 1-alpha/beta; Signal Transductor and Activator of Transcription 1; STAT 1; STAT 91; Stat1; STAT1_HUMAN; STAT91; Transcription factor ISGF 3 components p91 p84; Transcription factor ISGF-3 components p91/p84; signal transducer and activator of transcription 1, 91kDa], [STAT1; STAT1; CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91] |
| Gene, Accession # | [STAT1], Gene ID: 6772, NCBI: NP_009330.1, UniProt: P42224 |
| Catalog # | MBS178387 |
| Price | $315 |
| Order / More Info | STAT1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Chapgier, A.; Boisson-Dupuis, S.; Jouanguy, E.; Vogt, G.; Feinberg, J.; Prochnicka-Chalufour, A.; Casrouge, A.; Yang, K.; Soudais, C.; Fieschi, C.; Santos, O. F.; Bustamante, J.; and 10 others : Novel STAT1 alleles in otherwise healthy patients with mycobacterial disease. PLoS Genet. 2: e131, 2006. Note: Electronic Article. 2. Ihle, J. N. : STATs: signal transducers and activators of transcription. Cell 84: 331-334, 1996. 3. Xiao, L.; Naganawa, T.; Obugunde, E.; Gronowicz, G.; Ornitz, D. M.; Coffin, J. D.; Hurley, M. M. : Stat1 controls postnatal bone formation by regulating fibroblast growth factor signaling in osteoblasts. J. Biol. Chem. 279: 27743-27752, 2004. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies