CD36 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CD36 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CD36 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Platelet glycoprotein 4(CD36) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: CD36 (cluster of differentiation 36), also known as FAT (fatty acid translocase), FAT/CD36, (FAT)/CD36, SCARB3, GP88, glycoprotein IV (gpIV), and glycoprotein IIIb (gpIIIb), is anintegral membrane protein found on the surface of many cell types in vertebrate animals. CD36 is a member of the class B scavenger receptor family of cell surface proteins. It is mapped to 7q21.11. And CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. In add |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids. Ig Type: Rabbit IgG |
| Other Names | [Platelet glycoprotein 4; Adipocyte membrane protein; CD36; CD36; CD36 antigen (collagen type I receptor, thrombospondin receptor); CD36 antigen; CD36 molecule (thrombospondin receptor); CD36 molecule; CD36_HUMAN; CHDS7; Cluster determinant 36; Collagen receptor, platelet; FAT; Fatty acid translocase; Fatty acid transport protein; Glycoprotein IIIb; GP IIIb; GP3B; GP4; GPIIIB; GPIV; Leukocyte differentiation antigen CD36; MGC108510; MGC91634; PAS 4 protein; PAS IV; PAS-4; PASIV; Platelet collagen receptor; Platelet glycoprotein 4; Platelet glycoprotein IV; scarb3; Scavenger receptor class B member 3; Thrombospondin receptor; CD36 molecule (thrombospondin receptor)], [CD36; CD36; FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10; GP3B; GP4; FAT; GPIIIB; GPIV] |
| Gene, Accession # | [CD36], Gene ID: 948, NCBI: NP_000063.2, UniProt: P16671 |
| Catalog # | MBS177847 |
| Price | $315 |
| Order / More Info | CD36 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Tandon NN, Kralisz U, Jamieson GA (5 May 1989). Identification of glycoprotein IV (CD36) as a primary receptor for platelet-collagen adhesion. J. Biol. Chem. 264 (13): 7576-83. PMID 2468670. 2. Jump up ^ Silverstein RL, Baird M, Lo SK, Yesner LM (15 August 1992). Sense and antisense cDNA transfection of CD36 (glycoprotein IV) in melanoma cells. Role of CD36 as a thrombospondin receptor. J. Biol. Chem. 267 (23): 16607-12. PMID 1379600. 3. Kuda O, Pietka TA, Demianova Z, Kudova E, Cvacka J, Kopecky J, Abumrad NA (May 2013). Sulfo-N-succinimidyl Oleate (SSO) Inhibits Fatty Acid Uptake and Signaling for Intracellular Calcium via Binding CD36 Lysine 164: SSO ALSO INHIBITS OXIDIZED LOW DENSITY LIPOPROTEIN UPTAKE BY MACROPHAGES.. J. Biol. Chem. 288 (22): 15547-55. doi:10.1074/jbc.M113.473298.PMID 23603908. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies