CD45 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CD45 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CD45 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Receptor-type tyrosine-protein phosphatase C(PTPRC) detection. Tested with WB, IHC-P in Human. Background: CD45 (Cluster of Differentiation 45), also known as PTPRC, LCA or CD45R, is an enzyme that, in humans, is encoded by the PTPRC gene. It is a member of the protein tyrosine phosphatase (PTP) family. CD45 is a major high molecular mass leukocyte cell surface molecule which is also an integral membrane protein tyrosine phosphatase. The cytogenetic location of CD45 is 1q31.3-q32.1. This gene is especially a prototype for transmembrane protein-tyrosine phosphatase (PTP). Targeted disruption of the CD45 gene leads to enhanced cytokine and interferon receptor-mediated activation of JAKs and STAT |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD45(1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK), different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids. Ig Type: Rabbit IgG |
| Other Names | [Receptor-type tyrosine-protein phosphatase C; B220; CD 45; CD45; CD45 antigen; CD45R; GP180; L CA; L-CA; LCA; Leukocyte common antigen; loc; Ly-5; LY5; Lyt-4; OTTHUMP00000033813; OTTHUMP00000033816; OTTHUMP00000033817; OTTHUMP00000038574; Protein tyrosine phosphatase receptor type C; Protein tyrosine phosphatase receptor type c polypeptide; protein tyrosine phosphatase, receptor type, C; PTPRC; PTPRC_HUMAN; Receptor-type tyrosine-protein phosphatase C; SCID due to PTPRC deficiency; T200; T200 glycoprotein; T200 leukocyte common antigen; protein tyrosine phosphatase, receptor type, C], [PTPRC; PTPRC; LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180; CD45; L-CA] |
| Gene, Accession # | [CD45], Gene ID: 5788, NCBI: NP_002829.3, UniProt: P08575 |
| Catalog # | MBS178068 |
| Price | $315 |
| Order / More Info | CD45 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Anderson, J.N. et al. (2004) FASEB J. 18:8. 2. Akao, Y., Utsumi, K. R., Naito, K., Ueda, R., Takahashi, T., Yamada, K. Chromosomal assignments of genes coding for human leukocyte common antigen, T-200, and lymphocyte function-associated antigen 1, LFA-1 beta subunit. Somat. Cell Molec. Genet. 13: 273-278, 1987. 3. Falahti, R. and D. Leitenberg (2008) J. Immunol. 181:6082. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies