Integrin alpha 3B Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Integrin alpha 3B antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Integrin alpha 3B |
| Clone | [54B3] |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: 54B3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart. Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell gro |
| Immunogen | Source Note: 54B3 is a Mouse monoclonal IgG1 antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. |
| Other Names | [integrin, alpha 3b; integrin, alpha 3b; bdf; fyd; itga3; badfin; frayed; unm tz296; unm_tz296; integrin alpha 3; integrin, alpha 3b], [itga3b; im:7145180; im:7155971] |
| Gene, Accession # | Gene ID: 100331874, NCBI: NP_001177238.1 |
| Catalog # | MBS570101 |
| Price | $415 |
| Order / More Info | Integrin alpha 3B Antibody from MYBIOSOURCE INC. |
| Product Specific References | de Melker, AA, Sterk, LM, Delwel, GO, Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies