Fascin Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Fascin antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Fascin |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human;Rat. Background: Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. Ig Type: Rabbit IgG |
| Other Names | [Fascin; 55 kDa actin bundling protein; 55 kDa actin-bundling protein; Actin bundling protein; actin bundling protein, 55-KD; FAN 1; FAN1; Fascin 1; Fascin; Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus); Fascin homolog 1; Fascin, sea urchin, homolog of, 1; Fascin1; FLJ38511; FSCN 1; FSCN1; FSCN1_HUMAN; HSN; p55; Singed (Drosophila) like (sea urchin fascin homolog like); Singed drosophila homolog like; Singed like (fascin homolog sea urchin) (Drosophila); Singed like (fascin homolog sea urchin); Singed like protein; Singed, drosophila, homolog of; Singed-like protein; SNL; Strongylocentrotus purpuratus; fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)], [FSCN1; FSCN1; HSN; SNL; p55; FAN1; FAN1; HSN; SNL] |
| Gene, Accession # | Gene ID: 6624, NCBI: NP_003079.1, UniProt: Q16658 |
| Catalog # | MBS177840 |
| Price | $280 |
| Order / More Info | Fascin Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Saishin, Y., Shimada, S., Morimura, H., Sato, K., Ishimoto, I., Tano, Y., Tohyama, M.Isolation of a cDNA encoding a photoreceptor cell-specific actin-bundling protein: retinal fascin.FEBS Lett. 414: 381-386, 1997. 2. Wada, Y., Abe, T., Takeshita, T., Sato, H., Yanashima, K., Tamai, M.Mutation of human retinal fascin gene (FSCN2) causes autosomal dominant retinitis pigmentosa.Invest. Ophthal. Vis. Sci. 42: 2395-2400, 2001. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies