PCDH15 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PCDH15 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PCDH15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for PCDH15 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: Protocadherin-15 is a protein that in humans is encoded by the PCDH15 gene. This gene is mapped to 10q21.1. This gene is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). Extensive alternative splicing resulting in multiple isoforms has been observed in the mouse ortholog. Similar alternatively spliced transcripts ar |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human PCDH15 (DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ). |
| Other Names | [Protocadherin-15; PCDH15; USH1F; Protocadherin related 15] |
| Gene, Accession # | [PCDH15], Gene ID: 65217, NCBI: NP_149045.3, UniProt: Q96QU1 |
| Catalog # | MBS1751458 |
| Price | $315 |
| Order / More Info | PCDH15 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Ahmed, Z. M., Riazuddin, S., Ahmad, J., Bernstein, S. L., Guo, Y., Sabar, M. F., Sieving, P., Riazuddin, S., Griffith, A. J., Friedman, T. B., Belyantseva, I. A., Wilcox, E. R. PCDH15 is expressed in the neurosensory epithelium of the eye and ear and mutant alleles are responsible for both USH1F and DFNB23. Hum. Molec. Genet. 12: 3215-3223, 2003. 2. Ahmed, Z. M., Riazuddin, S., Aye, S., Ali, R. A., Venselaar, H., Anwar, S., Belyantseva, P. P., Qasim, M., Riazuddin, S., Friedman, T. B. Gene structure and mutant alleles of PCDH15: nonsyndromic deafness DFNB23 and type 1 Usher syndrome. Hum. Genet. 124: 215-223, 2008. 3. Ahmed, Z. M., Riazuddin, S., Bernstein, S. L., Ahmed, Z., Khan, S., Griffith, A. J., Morell, R. J., Friedman, T. B., Riazuddin, S., Wilcox, E. R. Mutations of the protocadherin gene PCDH15 cause Usher syndrome type 1F. Am. J. Hum. Genet. 69: 25-34, 2001. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies