TH Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TH antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TH |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | mouse, rat. predicted to work with: human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Tyrosine 3-monooxygenase(TH) detection. Tested with WB, IHC-P in Mouse;Rat. Background: TH is equal to tyrosine hydroxylase. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal me |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TH (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [Tyrosine 3-monooxygenase; Dystonia 14; DYT14; DYT5b; EC 1.14.16.2; OTTHUMP00000011225; OTTHUMP00000011226; ple; Protein Pale; TH; The; TY3H_HUMAN; TYH; Tyrosine 3 hydroxylase; Tyrosine 3 monooxygenase; Tyrosine 3-hydroxylase; Tyrosine 3-monooxygenase; Tyrosine hydroxylase; tyrosine hydroxylase], [TH; TH; TYH; DYT14; DYT5b; TYH; TH] |
| Gene, Accession # | [TH], Gene ID: 7054, NCBI: NP_000351.2, UniProt: P07101 |
| Catalog # | MBS178217 |
| Price | $315 |
| Order / More Info | TH Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Haavik J, Toska K (June 1998). Tyrosine hydroxylase and Parkinson's disease. Mol. Neurobiol. 16 (3): 285-309. 2. Kaufman S (1995). Tyrosine hydroxylase. Adv. Enzymol. Relat. Areas Mol. Biol. Advances in Enzymology - and Related Areas of Molecular Biology 70: 103-220. Nagatsu T (1995). Tyrosine hydroxylase: human isoforms, structure and regulation in physiology and pathology. Essays Biochem.30: 15-35. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies