Edit |   |
---|---|
Antigenic Specificity | MPZL1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: MPZL1 antibody was raised against the middle region of MPZL1. Rabbit polyclonal MPZL1 antibody raised against the middle region of MPZL1 |
Immunogen | Immunogen: MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE |
Other Names | [MPZL1; MPZL1; FLJ21047; MPZL 1; PZR1b; MPZL1; MPZL-1; PZRb; Myelin Protein Zero-Like 1; PZR; PZRa], [MPZL1; MPZL1; PZR; PZRa; PZRb; PZR1b; MPZL1b; PZR] |
Gene, Accession # | [MPZL1], Gene ID: 9019, NCBI: CAG46957.1, UniProt: O95297 |
Catalog # | MBS839450 |
Price | $430 |
Order / More Info | MPZL1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |