Edit |   |
---|---|
Antigenic Specificity | CENPA |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 1.94 mg/ml |
Applications | Western Blot (WB), Immunofluorescence (IF) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA (NP 001800.1). Immunogen Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA |
Other Names | [CENPA; CENP-A; CenH3; centromere protein A] |
Gene, Accession # | [CENPA], Gene ID: 1058, NCBI: NP_001035891.1, UniProt: P49450 |
Catalog # | MBS9140670 |
Price | $260 |
Order / More Info | CENPA Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |