Heparanase 1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Heparanase 1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Heparanase 1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for Heparanase(HPSE) detection. Tested with WB in Human;Rat. Background: Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids. Ig Type: Rabbit IgG |
| Other Names | [Heparanase; Endo glucoronidase; Endo-glucoronidase; HEP; Heparanase 50 kDa subunit; Heparanase; Heparanase-1; Heparanase1; Hpa 1; HPA; Hpa1; HPR 1; HPR1; HPSE 1; HPSE; HPSE_HUMAN; HPSE1; HSE 1; HSE1; heparanase], [HPSE; HPSE; HPA; HPA1; HPR1; HSE1; HPSE1; HEP; HPA; HPA1; HPR1; HPSE1; HSE1; Hpa1] |
| Gene, Accession # | Gene ID: 10855, NCBI: NP_001092010.1, UniProt: Q9Y251 |
| Catalog # | MBS178331 |
| Price | $280 |
| Order / More Info | Heparanase 1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Hulett MD, Freeman C, Hamdorf BJ, Baker RT, Harris MJ, Parish CR (July 1999), Cloning of mammalian heparanase, an important enzyme in tumor invasion and metastasis, Nature medicine 5 (7): 803-9. 2. Nakajima M, Irimura T, Nicolson GL. (1988), Heparanases and tumor metastasis, J. Cell. Biochem. 36 (2): 157-167. 3. Toyoshima, M.; Nakajima, M. : Human heparanase: purification, characterization, cloning, and expression. J. Biol. Chem. 274: 24153-24160, 1999. 4. Vlodavsky I, Friedmann Y, Elkin M, Aingorn H, Atzmon R, Ishai-Michaeli R, Bitan M, Pappo O, Peretz T, Michal I, Spector L, Pecker I (July 1999), Mammalian heparanase: gene cloning, expression and function in tumor progression and metastasis, Nature medicine 5 (7): 793-802. 5. Vlodavsky I, Goldshmidt O, Zcharia E, et al. (2003), Mammalian heparanase: involvement in cancer metastasis, angiogenesis and normal development., Semin. Cancer Biol. 12 (2): 121-9. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies