Edit |   |
---|---|
Antigenic Specificity | MS4A4A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: MS4A4A antibody was raised against the N terminal of MS4A4A. Rabbit polyclonal MS4A4A antibody raised against the N terminal of MS4A4A |
Immunogen | Immunogen: MS4A4A antibody was raised using the N terminal of MS4A4A corresponding to a region with amino acids MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL |
Other Names | [MS4A4A; MS4A4A; MS4A4; MSAA-4; CD20-L1; 4SPAN1; MS4A4A; CD20L1; MS4A7; Membrane-Spanning 4-Domains Subfamily A Member 4; MSAA 4; MGC22311; HDCME31P] |
Gene, Accession # | [MS4A4A], Gene ID: 51338, NCBI: NP_001230195.1 |
Catalog # | MBS5300196 |
Price | $430 |
Order / More Info | MS4A4A Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |