Cytokeratin 18 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Cytokeratin 18 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Cytokeratin 18 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 0.1 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: Cytokeratin 18 antibody was raised against the C terminal of KRT18. KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis. |
| Immunogen | Immunogen: Cytokeratin 18 antibody was raised using the C terminal of KRT18 corresponding to a region with amino acids ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIV |
| Other Names | [Rabbit Cytokeratin 18 raised against the C terminal of KRT18; Cytokeratin 18; Cytokeratin 18; Cytokeratin -18; Cytokeratin 18; Cytokeratin 18; CK18; Cytokeratin -18; KRT18; Keratin 18; Cytokeratin 18; K18] |
| Gene, Accession # | [CK-18], Gene ID: 3875 |
| Catalog # | MBS5312822 |
| Price | $400 |
| Order / More Info | Cytokeratin 18 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies