Talin 2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Talin 2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Talin 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat. |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Talin-2 (TLN2) detection. Background: Talin 2 is a protein in humans that is encoded by the TLN2 gene. It belongs to the talin protein family. This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Talin 2 (1787-1822aa NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV). |
| Other Names | [Talin2; Talin 2; Talin-2; TLN2; TLN 2; TLN-2; ILWEQ; Q9Y4G6; Talin-2; talin 2], [TLN2; TLN2; ILWEQ; KIAA0320] |
| Gene, Accession # | [TLN2], Gene ID: 83660, NCBI: NP_055874.2, UniProt: Q9Y4G6 |
| Catalog # | MBS178461 |
| Price | $315 |
| Order / More Info | Talin 2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: Talin 2.2. Monkley SJ, Pritchard CA, Critchley DR (Sep 2001). Analysis of the mammalian talin2 gene TLN2. Biochemical and Biophysical Research Communications 286 (5): 880-5.3. Praekelt U, Kopp PM, Rehm K, Linder S, Bate N, Patel B, Debrand E, Manso AM, Ross RS, Conti F, Zhang MZ, Harris RC, Zent R, Critchley DR, Monkley SJ (Mar 2012). New isoform-specific monoclonal antibodies reveal different sub-cellular localisations for talin1 and talin2. European Journal of Cell Biology 91 (3): 180-91. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies