ATP2A3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ATP2A3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ATP2A3 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | mouse, rat. predicted to work with: human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 3(ATP2A3) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. What's more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysi |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids. Ig Type: Rabbit IgG |
| Other Names | [Sarcoplasmic/endoplasmic reticulum calcium ATPase 3; Adenosine triphosphatase calcium; AT2A3_HUMAN; ATP2A3; ATPase Ca(2+) transporting ubiquitous; ATPase Ca++ transporting ubiquitous; Calcium pump 3; Calcium translocating P type ATPase; Sarco/endoplasmic reticulum Ca2+ ATPase; Sarcoplasmic/endoplasmic reticulum calcium ATPase 3; SERCA 3; SERCA3; SERCA3b; SR Ca(2+) ATPase 3; SR Ca(2+)-ATPase 3; ATPase, Ca++ transporting, ubiquitous], [ATP2A3; ATP2A3; SERCA3; SERCA3; SR Ca(2+)-ATPase 3] |
| Gene, Accession # | [ATP2A3], Gene ID: 489, NCBI: NP_005164.2, UniProt: Q93084 |
| Catalog # | MBS177877 |
| Price | $315 |
| Order / More Info | ATP2A3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Dode L, Wuytack F, Kools PF, Baba-Aissa F, Raeymaekers L, Brike F, van de Ven WJ, Casteels R (Nov 1996). 2. Gelebart, P., Kovacs, T., Brouland, J.-P., van Gorp, R., Grossmann, J., Rivard, N., Panis, Y., Martin, V., Bredoux, R., Enouf, J., Papp, B. Expression of endomembrane calcium pumps in colon and gastric cancer cells: induction of SERCA3 expression during differentiation. J. Biol. Chem. 277: 26310-26320, 2002. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies