Edit |   |
---|---|
Antigenic Specificity | LRP8 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: LRP8 antibody was raised against the middle region of LRP8. Rabbit polyclonal LRP8 antibody raised against the middle region of LRP8 |
Immunogen | Immunogen: LRP8 antibody was raised using the middle region of LRP8 corresponding to a region with amino acids ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV |
Other Names | [LRP8; LRP8; LRP 8; LRP-8; APOER2; MCI1; HSZ75190; LRP8; Low Density Lipoprotein Receptor-Related Protein 8 Apolipoprotein E Receptor] |
Gene, Accession # | [LRP8] |
Catalog # | MBS5302135 |
Price | $430 |
Order / More Info | LRP8 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |