Edit |   |
---|---|
Antigenic Specificity | E2F1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 0.1 mg |
Concentration | 0.65 ug/ul in antibody stabilization buffer |
Applications | ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Affinity Purified E2F transcription factor 1 Antibody N-epitope. Transcription activator that binds DNA cooperatively with DP proteins through E2 recognition site. |
Immunogen | Immunogen: Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
Other Names | [DmelCG6376; drosE2F1; E(Sev-CycE)3A; E(var)3-93E; Evar(3)164; l(3)07172; l(3)j3B1; l(3)j3C2; l(3)rM729; PBR 3; PRB binding protein E2F 1; RBAP 1; RBP 3; Retinoblastoma associated protein 1; Retinoblastoma binding protein 3; Transcription factor E2F1], [E2F1; E2F1; RBP3; E2F-1; RBAP1; RBBP3; RBBP3; E2F-1; RBAP-1; RBBP-3] |
Gene, Accession # | [E2F1], Gene ID: 1869, NCBI: Q01094.1, UniProt: Q01094 |
Catalog # | MBS540238 |
Price | $425 |
Order / More Info | E2F1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |