MMP12 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-MMP12 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | MMP12 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), ELISA (EIA) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Macrophage metalloelastase(MMP12) detection. Tested with WB, ELISA in Mouse. Background: Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids. Ig Type: Rabbit IgG |
| Other Names | [Macrophage metalloelastase; EC 3.4.24.65; HME; Macrophage elastase; Macrophage metalloelastase; Macrophage metaloelastase; Matrix metallopeptidase 12 (macrophage elastase); Matrix metalloprotease 12; Matrix metalloproteinase-12; ME; MGC138506; MME; MMP 12; MMP-12; Mmp12; MMP12_HUMAN; matrix metallopeptidase 12 (macrophage elastase)], [Mmp12; Mmp12; MME; Mmel; AV378681; Mme; Mmel; MME; MMP-12] |
| Gene, Accession # | [MMP12], Gene ID: 17381, NCBI: NP_001307005.1, UniProt: P34960 |
| Catalog # | MBS178278 |
| Price | $280 |
| Order / More Info | MMP12 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Houghton, A. M., Hartzell, W. O., Robbins, C. S., Gomis-Ruth, F. X., Shapiro, S. D.Macrophage elastase kills bacteria within murine macrophages. Nature 460: 637-641, 2009. 2. Joos, L., He, J.-Q., Shepherdson, M. B., Connett, J. E., Anthonisen, N. R., Pare, P. D., Sandford, A. J. The role of matrix metalloproteinase polymorphisms in the rate of decline in lung function. Hum. Molec. Genet. 11: 569-576, 2002. Note: Erratum: Hum. Molec. Genet. 12: 803-804, 2003. 3. Wu, L., Tanimoto, A., Murata, Y., Sasaguri, T., Fan, J., Sasaguri, Y., Watanabe, T. Matrix metalloproteinase-12 gene expression in human vascular smooth muscle cells.Genes Cells 8: 225-234, 2003. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies