ABP1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ABP1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ABP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Amiloride-sensitive amine oxidase [copper-containing](AOC1) detection. Background: This gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regula |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1 (144-180aa STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR), different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids. |
| Other Names | [ABP; Abp1; AOC1; DAO; DAO1; Diamine oxidase; Histaminase; KAO; Kidney amine oxidase; P19801; Amiloride-sensitive amine oxidase [copper-containing]; amine oxidase, copper containing 1], [AOC1; AOC1; ABP; DAO; KAO; ABP1; DAO1; ABP1; DAO1; DAO; Diamine oxidase; KAO] |
| Gene, Accession # | [AOC1], Gene ID: 26, NCBI: NP_001082.2, UniProt: P19801 |
| Catalog # | MBS178796 |
| Price | $280 |
| Order / More Info | ABP1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Human kidney amiloride-binding protein: cDNA structure and functional expression.Barbry P., Champe M., Chassande O., Munemitsu S., Champigny G., Lingueglia E., Maes P., Frelin C., Tartar A., Ullrich A., Lazdunski M.Proc. Natl. Acad. Sci. U.S.A. 87: 7347-7351(1990).2. Structure and inhibition of human diamine oxidase.McGrath A.P., Hilmer K.M., Collyer C.A., Shepard E.M., Elmore B.O., Brown D.E., Dooley D.M., Guss J.M.Biochemistry 48: 9810-9822(2009). |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies