Edit |   |
Antigenic Specificity | GTPase HRAS |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | mouse, rat. predicted to work with: human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human;Mouse;Rat. Background: GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease character |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
Other Names | [GTPase Hras; C BAS/HAS; c H ras; C HA RAS1; c has/bas p21 protein; c ras Ki 2 activated oncogene; c-H-ras; CTLO; GTP and GDP binding peptide B; GTPase HRas, N-terminally processed; H Ras 1; H RASIDX; H-Ras-1; Ha Ras; Ha Ras1 proto oncoprotein; Ha-Ras; HAMSV; Harvey rat sarcoma viral oncogene homolog; Harvey rat sarcoma viral oncoprotein; HRAS; HRAS1; K ras; N ras; p19 H RasIDX protein; p21ras; Ras family small GTP binding protein H Ras; RASH_HUMAN; RASH1; Transformation gene oncogene HAMSV; Transforming protein p21; v Ha ras Harvey rat sarcoma viral oncogene homolog; VH Ras; vHa RAS; Harvey rat sarcoma viral oncogene homolog], [HRAS; HRAS; CTLO; HAMSV; HRAS1; RASH1; p21ras; C-H-RAS; H-RASIDX; C-BAS/HAS; C-HA-RAS1; HRAS1] |
Gene, Accession # | [GTPase HRAS], Gene ID: 3265, NCBI: NP_001123914.1, UniProt: P01112 |
Catalog # | MBS178394 |
Price | $315 |
Order / More Info | GTPase HRAS Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Entrez Gene: v-Ha-ras Harvey rat sarcoma viral oncogene homolog. 2. Russell MW, Munroe DJ, Bric E, Housman DE, Dietz-Band J, Riethman HC, Collins FS, Brody LC (July 1996). A 500-kb physical map and contig from the Harvey ras-1 gene to the 11p telomere. Genomics 35 (2): 353-60. 3. Wong-Staal F, Dalla-Favera R, Franchini G, Gelmann EP, Gallo RC (July 1981). Three distinct genes in human DNA related to the transforming genes of mammalian sarcoma retroviruses. Science 213 (4504): 226-8. |