Edit |   |
---|---|
Antigenic Specificity | CXCR1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 1.38 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. Knockout studies in mice suggested that this protein inhibits embryonic oligodendrocyte precursor migration in developing spinal cord. This gene, IL8RB, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CXCR1 (NP 000625.1). Immunogen Sequence: IFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL |
Other Names | [CXCR1; C-C; C-C-CKR-1; CD128; CD181; CDw128a; CKR-1; CMKAR1; IL8R1; IL8RA; IL8RBA; C-X-C chemokine receptor type 1] |
Gene, Accession # | [CXCR1], Gene ID: 3577, NCBI: AAY21515.1, UniProt: P25024 |
Catalog # | MBS9140820 |
Price | $260 |
Order / More Info | CXCR1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |