Edit |   |
---|---|
Antigenic Specificity | Beta Tubulin 2A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, Arabidopsis, Drosophila |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: Beta Tubulin 2A antibody was raised against the middle region of TUBB2A. Rabbit polyclonal Beta Tubulin 2A antibody raised against the middle region of TUBB2A |
Immunogen | Immunogen: Beta Tubulin 2A antibody was raised using the middle region of TUBB2A corresponding to a region with amino acids AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC |
Other Names | n/a |
Gene, Accession # | n/a |
Catalog # | MBS839827 |
Price | $430 |
Order / More Info | Beta Tubulin 2A Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |