TMEM107 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TMEM107 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TMEM107 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Cilia are dynamic signaling organelles essential for developmental patterning, including left-right specification, skeletal formation, neural development, and organogenesis. TMEM107 is predicted to be critical for cilia formation and signaling in a subset of embryonic tissues. Based on an alignment of theTMEM107 sequence with the genomic sequence (GRCh38), the TMEM107 gene was mapped to chromosome 17p13.1.Protein Function: Plays a role in cilia formation and embryonic patterning. Requires for normal Sonic hedgehog (Shh) signaling in the neural tube and acts in combination with GLI2 and GLI3 to pattern ventral and intermediate neuronal cell types (By similarity). |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids. Subcellular Localization: Membrane; Multi-pass membrane protein. |
| Other Names | [Transmembrane protein 107; TMEM107; DC20; UNQ638/PRO1268] |
| Gene, Accession # | [TMEM107], Gene ID: 84314, NCBI: NP_115730.2, UniProt: Q6UX40 |
| Catalog # | MBS1750887 |
| Price | $315 |
| Order / More Info | TMEM107 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies