NARG1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-NARG1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | NARG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for N-alpha-acetyltransferase 15, NatA auxiliary subunit(NAA15) detection. Background: NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (Nalpha-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Hunti |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NARG1 (244-287aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY), different from the related mouse sequence by one amino acid. |
| Other Names | [ASTBDN; GA19; mNAT1; Naa15; NATH; Tbdn 1; Tbdn100; tubedown-1; Q9BXJ9; N-alpha-acetyltransferase 15, NatA auxiliary subunit], [NAA15; NAA15; Ga19; NATH; TBDN; NARG1; NAT1P; TBDN100; GA19; NARG1; NATH; TBDN100] |
| Gene, Accession # | [NAA15], Gene ID: 80155, NCBI: NP_476516.1, UniProt: Q9BXJ9 |
| Catalog # | MBS178695 |
| Price | $315 |
| Order / More Info | NARG1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Arnesen, T., Anderson, D., Baldersheim, C., Lanotte, M., Varhaug, J. E., Lillehaug, J. R. Identification and characterization of the human ARD1-NATH protein acetyltransferase complex. Biochem. J. 386: 433-443, 2005.2. Fluge, O., Bruland, O., Akslen, L. A., Varhaug, J. E., Lillehaug, J. R. NATH, a novel gene overexpressed in papillary thyroid carcinomas. Oncogene 21: 5056-5068, 2002.3. Sugiura, N., Patel, R. G., Corriveau, R. A. N-methyl-D-aspartate receptors regulate a group of transiently expressed genes in the developing brain. J. Biol. Chem. 276: 14257-14263, 2001. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies