Edit |   |
---|---|
Antigenic Specificity | RFPL4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 2.33 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | n/a |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RFPL4 (NP 001138486.1). Immunogen Sequence: MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTF |
Other Names | [RFPL4A; RFPL4; RNF210; ret finger protein-like 4A] |
Gene, Accession # | [RFPL4], Gene ID: 342931, NCBI: NP_001138486.1, UniProt: A6NLU0 |
Catalog # | MBS9140667 |
Price | $260 |
Order / More Info | RFPL4 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |