CD272/BTLA Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CD272/BTLA antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CD272/BTLA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for CD272/BTLA detection. Tested with WB, IHC-P in Human; Mouse.Background: B- and T-lymphocyte attenuator is a protein that in humans is encoded by the BTLA gene. BTLA has also been designated as CD272 (cluster of differentiation 272). This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. BTLA expression is induced during activation |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL). |
| Other Names | [B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein; CD272; BTLA; B and T lymphocyte associated] |
| Gene, Accession # | [CD272], Gene ID: 151888, NCBI: NP_001078826.1, UniProt: Q7Z6A9 |
| Catalog # | MBS1751449 |
| Price | $315 |
| Order / More Info | CD272/BTLA Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Watanabe N, Gavrieli M, Sedy JR, Yang J, Fallarino F, Loftin SK, Hurchla MA, Zimmerman N, Sim J, Zang X, Murphy TL, Russell JH, Allison JP, Murphy KM (July 2003). 2. BTLA is a lymphocyte inhibitory receptor with similarities to CTLA-4 and PD-1. Nature Immunology. 4 (7): 670-9. 3. Entrez Gene: BTLA B and T lymphocyte associated. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies