Edit |   |
---|---|
Antigenic Specificity | SLC25A24 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | Protein A purified |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal SLC25A24 antibody |
Immunogen | Immunogen: SLC25A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA |
Other Names | [SLC25A24; SLC25A24; Solute Carrier Family 25 Member 24; SCAMC-1; APC1; SLCA24-25; RP11-356N1.3; Mitochondrial Carrier Phosphate Carrier 24; DKFZp586G0123; SLCA24 25; SLC25A24] |
Gene, Accession # | [SLC25A24], Gene ID: 229731, NCBI: AAH22637.1 |
Catalog # | MBS5302296 |
Price | $355 |
Order / More Info | SLC25A24 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |