SRY Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SRY Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SRY Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.Protein Function: Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells (By similarity). In mal |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR). Subcellular Localization: Nucleus speckle. Cytoplasm. Colocalizes with SOX6 in speckles. Colocalizes with CAML in the nucleus. Colocalizes in the nucleus with ZNF208 isoform KRAB-O and tyrosine hydroxylase (TH) (By similarity). |
| Other Names | [Sex-determining region Y protein; Testis-determining factor; SRY; TDF] |
| Gene, Accession # | [SRY], Gene ID: 6736, NCBI: NP_003131.1, UniProt: Q05066 |
| Catalog # | MBS1750448 |
| Price | $280 |
| Order / More Info | SRY Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies