Edit |   |
---|---|
Antigenic Specificity | Karyopherin Alpha 4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Karyopherin Alpha 4 antibody |
Immunogen | Immunogen: Karyopherin Alpha 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI |
Other Names | [Karyopherin Alpha 4; Karyopherin Alpha 4; MGC26703; Karyopherin Alpha 4; Importin Alpha 3; Karyopherin Alpha -4; MGC12217; KPNA4; QIP1; IPOA3; SRP3], [Kpna4] |
Gene, Accession # | NCBI: AAG42105.2 |
Catalog # | MBS838880 |
Price | $430 |
Order / More Info | Karyopherin Alpha 4 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |